https://github.com/biocommons/seqrepo-rest-service
OpenAPI-based REST interface to biological sequences and sequence metadata
Science Score: 26.0%
This score indicates how likely this project is to be science-related based on various indicators:
-
○CITATION.cff file
-
✓codemeta.json file
Found codemeta.json file -
○.zenodo.json file
-
✓DOI references
Found 2 DOI reference(s) in README -
○Academic publication links
-
○Academic email domains
-
○Institutional organization owner
-
○JOSS paper metadata
-
○Scientific vocabulary similarity
Low similarity (10.1%) to scientific vocabulary
Keywords
Repository
OpenAPI-based REST interface to biological sequences and sequence metadata
Basic Info
Statistics
- Stars: 4
- Watchers: 4
- Forks: 5
- Open Issues: 3
- Releases: 1
Topics
Metadata Files
README.md
seqrepo-rest-api
Provides SeqRepo and GA4GH RefGet REST interfaces to biological sequences and sequence metadata from an existing seqrepo sequence repository.
Description
Specific, named biological sequences provide the reference and coordinate sysstem for communicating variation and consequential phenotypic changes. Several databases of sequences exist, with significant overlap, all using distinct names. Furthermore, these systems are often difficult to install locally.
Clients refer to sequences and metadata using familiar identifiers, such as NM_000551.3 or GRCh38:1, or any of several hash-based identifiers. The interface supports fast slicing of arbitrary regions of large sequences.
A "fully-qualified" identifier includes a namespace to disambiguate accessions (e.g., "1" in GRCh37 and GRCh38). If the namespace is provided, seqrepo uses it as-is. If the namespace is not provided and the unqualified identifier refers to a unique sequence, it is returned; otherwise, ambiguous identifiers will raise an error.
SeqRepo favors identifiers from identifiers.org whenever available. Examples include refseq and ensembl.
This repository is the REST interface only. The underlying data is provided by seqrepo.
This repository also implements the GA4GH refget (v1)
protocol at
<baseurl>/refget/.
Released under the Apache License, 2.0.
Links: Issues | Docker image
Citation
Hart RK, Prlić A (2020)
SeqRepo: A system for managing local collections of biological sequences.
PLoS ONE 15(12): e0239883. https://doi.org/10.1371/journal.pone.0239883
Examples
OpenAPI docs
The REST interface is implemented with OpenAPI. Current and interactive documentation is available at the base url for the endpoint.

Fetch Sequence
Fetch sequence by an accession:
$ curl -f http://0.0.0.0:5000/seqrepo/1/sequence/NP_001274413.1
MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLPPGAGHILRTYNFPVLSCVSSCHLIGGKMPEN
Or not:
$ curl -f http://0.0.0.0:5000/seqrepo/1/sequence/bogus
curl: (22) The requested URL returned error: 404 NOT FOUND
Popular digests are also available:
$ curl -f http://0.0.0.0:5000/seqrepo/1/sequence/MD5:d52770ec477d0c9ee01fa034aff62cb4
MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLPPGAGHILRTYNFPVLSCVSSCHLIGGKMPEN
With range:
# 👉 Seqrepo uses interbase coordinates.
$ curl -f "http://0.0.0.0:5000/seqrepo/1/sequence/NP_001274413.1?start=5&end=10"
VWLSC
Fetch Metadata
$ curl -f "http://0.0.0.0:5000/seqrepo/1/metadata/GRCh38:1"
{
"added": "2016-08-27T21:17:00Z",
"aliases": [
"GRCh38:1",
"GRCh38:chr1",
"GRCh38.p1:1",
"GRCh38.p1:chr1",
⋮
"GRCh38.p9:chr1",
"MD5:6aef897c3d6ff0c78aff06ac189178dd",
"refseq:NC_000001.11",
"SEGUID:FCUd6VJ6uikS/VWLbhGdVmj2rOA",
"SHA1:14251de9527aba2912fd558b6e119d5668f6ace0",
"sha512t24u:Ya6Rs7DHhDeg7YaOSg1EoNi3U_nQ9SvO",
"ga4gh:SQ.Ya6Rs7DHhDeg7YaOSg1EoNi3U_nQ9SvO"
],
"alphabet": "ACGMNRT",
"length": 248956422
}
Development
$ make devready
$ source venv/bin/activate
Running a local instance
Once installed as above, you should be able to:
$ seqrepo-rest-service /usr/local/share/seqrepo/2021-01-29
The navigate to the URL shown in the console output.
Building and running a docker image
A docker image can be built with this repo or pulled from docker hub. In either case, the container requires an existing local seqrepo sequence repository.
To build a docker image in this repo:
make docker-image
This will create biocommons/seqrepo-rest-service:latest, like this:
$ docker images
REPOSITORY TAG IMAGE ID CREATED SIZE
biocommons/seqrepo-rest-service latest ad9ca051c5c9 2 minutes ago 627MB
This docker image is periodically pushed to docker hub.
Invoke the docker image like this this:
docker run \
--name seqrepo-rest-service \
--detach --rm -p 5000:5000 \
-v /usr/local/share/seqrepo/2021-01-29:/mnt/seqrepo \
biocommons/seqrepo-rest-service \
seqrepo-rest-service /mnt/seqrepo
Where the command line options are as follows:
* --name seqrepo-rest-service: Assigns the name seqrepo-rest-service to the container
* --detach: Runs the container in background and prints the container ID
* --rm: Automatically removes the container when it exits
* -p 5000:5000: Publishes a container’s port(s), 5000:5000, to the local host
* -v /usr/local/share/seqrepo/2021-01-29:/mnt/seqrepo: Binds the local volume, /usr/local/share/seqrepo/2021-01-29 to the address /mnt/seqrepo within the container
* biocommons/seqrepo-rest-service: Specifies the docker image (as built above)
* seqrepo-rest-service: Specifies the console name or entry point seqrepo_rest_service.cli:main
* /mnt/seqrepo: Specifies the SeqRepo instance directory, as corresponding to the volume above
You should then be able to fetch a test sequence like this:
$ curl 'http://127.0.0.1:5000/seqrepo/1/sequence/refseq:NM_000551.3?end=20'
CCTCGCCTCCGTTACAACGG
If things aren't working, check the logs with docker logs -f seqrepo-rest-service.
Owner
- Name: biocommons
- Login: biocommons
- Kind: organization
- Website: https://github.com/biocommons/biocommons/wiki/Welcome
- Repositories: 19
- Profile: https://github.com/biocommons
a collection of open source bioinformatics tools
GitHub Events
Total
- Issues event: 1
- Watch event: 2
- Delete event: 2
- Push event: 1
- Pull request event: 4
- Fork event: 2
Last Year
- Issues event: 1
- Watch event: 2
- Delete event: 2
- Push event: 1
- Pull request event: 4
- Fork event: 2
Issues and Pull Requests
Last synced: 7 months ago
All Time
- Total issues: 1
- Total pull requests: 2
- Average time to close issues: N/A
- Average time to close pull requests: 5 months
- Total issue authors: 1
- Total pull request authors: 2
- Average comments per issue: 0.0
- Average comments per pull request: 0.0
- Merged pull requests: 1
- Bot issues: 0
- Bot pull requests: 0
Past Year
- Issues: 1
- Pull requests: 1
- Average time to close issues: N/A
- Average time to close pull requests: 1 minute
- Issue authors: 1
- Pull request authors: 1
- Average comments per issue: 0.0
- Average comments per pull request: 0.0
- Merged pull requests: 0
- Bot issues: 0
- Bot pull requests: 0
Top Authors
Issue Authors
- reece (2)
- theferrit32 (1)
Pull Request Authors
- jsstevenson (5)
- jPleyte (2)
- bpeterman (1)
- melissacline (1)
- korikuzma (1)
- theferrit32 (1)
Top Labels
Issue Labels
Pull Request Labels
Packages
- Total packages: 1
-
Total downloads:
- pypi 20 last-month
- Total dependent packages: 0
- Total dependent repositories: 0
- Total versions: 2
- Total maintainers: 3
pypi.org: seqrepo-rest-service
SeqRepo REST Service
- Homepage: https://github.com/biocommons/seqrepo-rest-service
- Documentation: https://seqrepo-rest-service.readthedocs.io/
- License: MIT License
-
Latest release: 0.2.2
published over 2 years ago
Rankings
Maintainers (3)
Dependencies
- actions/checkout v3 composite
- docker/build-push-action v2 composite
- docker/login-action v1 composite
- docker/metadata-action v3 composite
- actions/checkout v3 composite
- crazy-max/ghaction-github-labeler v4 composite
- actions/checkout v3 composite
- actions/setup-python v4 composite
- pypa/gh-action-pypi-publish release/v1 composite
- actions/stale v8 composite
- ubuntu 22.04 build