deepfri

Deep functional residue identification

https://github.com/flatironinstitute/deepfri

Science Score: 67.0%

This score indicates how likely this project is to be science-related based on various indicators:

  • CITATION.cff file
  • codemeta.json file
    Found codemeta.json file
  • .zenodo.json file
    Found .zenodo.json file
  • DOI references
    Found 1 DOI reference(s) in README
  • Academic publication links
    Links to: biorxiv.org
  • Committers with academic emails
    2 of 4 committers (50.0%) from academic institutions
  • Institutional organization owner
    Organization flatironinstitute has institutional domain (flatironinstitute.org)
  • JOSS paper metadata
  • Scientific vocabulary similarity
    Low similarity (11.8%) to scientific vocabulary

Keywords

class-activation-maps deep-learning gene-ontology graph-convolutional-networks machine-learning protein-data-bank tensorflow
Last synced: 7 months ago · JSON representation

Repository

Deep functional residue identification

Basic Info
  • Host: GitHub
  • Owner: flatironinstitute
  • License: bsd-3-clause
  • Language: Python
  • Default Branch: master
  • Homepage:
  • Size: 388 MB
Statistics
  • Stars: 325
  • Watchers: 9
  • Forks: 85
  • Open Issues: 33
  • Releases: 1
Topics
class-activation-maps deep-learning gene-ontology graph-convolutional-networks machine-learning protein-data-bank tensorflow
Created over 6 years ago · Last pushed about 3 years ago
Metadata Files
Readme License Citation

README.md

DeepFRI

Deep functional residue identification

Citing

``` @article {Gligorijevic2019, author = {Gligorijevic, Vladimir and Renfrew, P. Douglas and Kosciolek, Tomasz and Leman, Julia Koehler and Cho, Kyunghyun and Vatanen, Tommi and Berenberg, Daniel and Taylor, Bryn and Fisk, Ian M. and Xavier, Ramnik J. and Knight, Rob and Bonneau, Richard}, title = {Structure-Based Function Prediction using Graph Convolutional Networks}, year = {2019}, doi = {10.1101/786236}, publisher = {Cold Spring Harbor Laboratory}, URL = {https://www.biorxiv.org/content/early/2019/10/04/786236}, journal = {bioRxiv} }

```

Dependencies

DeepFRI is tested to work under Python 3.7.

The required dependencies for DeepFRI are TensorFlow, Biopython and scikit-learn. To install all dependencies run:

pip install .

Protein function prediction

To predict protein functions use predict.py script with the following options:

  • seq str, Protein sequence as a string
  • cmap str, Name of a file storing a protein contact map and sequence in *.npz file format (with the following numpy array variables: C_alpha, seqres. See examples/pdb_cmaps/)
  • pdb str, Name of a PDB file (cleaned)
  • pdb_dir str, Directory with cleaned PDB files (see examples/pdb_files/)
  • cmap_csv str, Filename of the catalogue (in *.csv file format) containg mapping between protein names and directory with *.npz files (see examples/catalogue_pdb_chains.csv)
  • fasta_fn str, Fasta filename (see examples/pdb_chains.fasta)
  • model_config str, JSON file with model filenames (see trained_models/)
  • ont str, Ontology (mf - Molecular Function, bp - Biological Process, cc - Cellular Component, ec - Enzyme Commission)
  • output_fn_prefix str, Output filename (sampe prefix for predictions/saliency will be used)
  • verbose bool, Whether or not to print function prediction results
  • saliency bool, Whether or not to compute class activaton maps (outputs a *.json file)

Generated files (see examples/outputs/): * output_fn_prefix_MF_predictions.csv Predictions in the *.csv file format with columns: Protein, GO-term/EC-number, Score, GO-term/EC-number name * output_fn_prefix_MF_pred_scores.json Predictions in the *.json file with keys: pdb_chains, Y_hat, goterms, gonames * output_fn_prefix_MF_saliency_maps.json JSON file storing a dictionary of saliency maps for each predicted function of every protein

DeepFRI offers 6 possible options for predicting functions. See examples below.

Option 1: predicting functions of a protein from its contact map

Example: predicting MF-GO terms for Parvalbumin alpha protein using its sequence and contact map (PDB: 1S3P):

```

python predict.py --cmap ./examples/pdb_cmaps/1S3P-A.npz -ont mf --verbose

```

Output:

txt Protein GO-term/EC-number Score GO-term/EC-number name query_prot GO:0005509 0.99824 calcium ion binding

Option 2: predicting functions of a protein from its sequence

Example: predicting MF-GO terms for Parvalbumin alpha protein using its sequence (PDB: 1S3P):

```

python predict.py --seq 'SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIDEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES' -ont mf --verbose

```

Output:

txt Protein GO-term/EC-number Score GO-term/EC-number name query_prot GO:0005509 0.99769 calcium ion binding

Option 3: predicting functions of proteins from a fasta file

```

python predict.py --fastafn examples/pdbchains.fasta -ont mf -v

```

Output:

txt Protein GO-term/EC-number Score GO-term/EC-number name 1S3P-A GO:0005509 0.99769 calcium ion binding 2J9H-A GO:0004364 0.46937 glutathione transferase activity 2J9H-A GO:0016765 0.19910 transferase activity, transferring alkyl or aryl (other than methyl) groups 2J9H-A GO:0097367 0.10537 carbohydrate derivative binding 2PE5-B GO:0003677 0.53502 DNA binding 2W83-E GO:0032550 0.99260 purine ribonucleoside binding 2W83-E GO:0001883 0.99242 purine nucleoside binding 2W83-E GO:0005525 0.99231 GTP binding 2W83-E GO:0019001 0.99222 guanyl nucleotide binding 2W83-E GO:0032561 0.99194 guanyl ribonucleotide binding 2W83-E GO:0032549 0.99149 ribonucleoside binding 2W83-E GO:0001882 0.99135 nucleoside binding 2W83-E GO:0017076 0.98687 purine nucleotide binding 2W83-E GO:0032555 0.98641 purine ribonucleotide binding 2W83-E GO:0035639 0.98611 purine ribonucleoside triphosphate binding 2W83-E GO:0032553 0.98573 ribonucleotide binding 2W83-E GO:0097367 0.98168 carbohydrate derivative binding 2W83-E GO:0003924 0.52355 GTPase activity 2W83-E GO:0016817 0.36863 hydrolase activity, acting on acid anhydrides 2W83-E GO:0016818 0.36683 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides 2W83-E GO:0017111 0.35465 nucleoside-triphosphatase activity 2W83-E GO:0016462 0.35303 pyrophosphatase activity

Option 4: predicting functions of proteins from contact map catalogue

```

python predict.py --cmapcsv examples/cataloguepdb_chains.csv -ont mf -v

```

Output:

txt Protein GO-term/EC-number Score GO-term/EC-number name 1S3P-A GO:0005509 0.99824 calcium ion binding 2J9H-A GO:0004364 0.84826 glutathione transferase activity 2J9H-A GO:0016765 0.82014 transferase activity, transferring alkyl or aryl (other than methyl) groups 2PE5-B GO:0003677 0.89086 DNA binding 2PE5-B GO:0017111 0.12892 nucleoside-triphosphatase activity 2PE5-B GO:0004386 0.12847 helicase activity 2PE5-B GO:0032553 0.12091 ribonucleotide binding 2PE5-B GO:0097367 0.11961 carbohydrate derivative binding 2PE5-B GO:0016887 0.11331 ATPase activity 2W83-E GO:0097367 0.97069 carbohydrate derivative binding 2W83-E GO:0019001 0.96842 guanyl nucleotide binding 2W83-E GO:0017076 0.96737 purine nucleotide binding 2W83-E GO:0001882 0.96473 nucleoside binding 2W83-E GO:0035639 0.96439 purine ribonucleoside triphosphate binding 2W83-E GO:0032555 0.96294 purine ribonucleotide binding 2W83-E GO:0016818 0.96181 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides 2W83-E GO:0032550 0.96142 purine ribonucleoside binding 2W83-E GO:0016817 0.96082 hydrolase activity, acting on acid anhydrides 2W83-E GO:0016462 0.95998 pyrophosphatase activity 2W83-E GO:0032553 0.95935 ribonucleotide binding 2W83-E GO:0032561 0.95930 guanyl ribonucleotide binding 2W83-E GO:0032549 0.95877 ribonucleoside binding 2W83-E GO:0003924 0.95453 GTPase activity 2W83-E GO:0001883 0.95271 purine nucleoside binding 2W83-E GO:0005525 0.94635 GTP binding 2W83-E GO:0017111 0.93942 nucleoside-triphosphatase activity 2W83-E GO:0044877 0.64519 protein-containing complex binding 2W83-E GO:0001664 0.31413 G protein-coupled receptor binding 2W83-E GO:0005102 0.20078 signaling receptor binding

Option 5: predicting functions of a protein from a PDB file

```

python predict.py -pdb ./examples/pdb_files/1S3P-A.pdb -ont mf -v

```

Output:

txt Protein GO-term/EC-number Score GO-term/EC-number name query_prot GO:0005509 0.99824 calcium ion binding

Option 6: predicting functions of a protein from a directory with PDB files

```

python predict.py --pdbdir ./examples/pdbfiles -ont mf --saliency --use_backprop

```

Output:

See files in: examples/outputs/

Training DeepFRI

To train DeepFRI run the following command from the project directory: ```

python train_DeepFRI.py -h ```

or to launch jobs run the following script: ```

./runtrainDeepFRI.sh ```

Output

Generated files: * model_name_prefix_ont_model.hdf5 trained model with architecture and weights saved in HDF5 format * model_name_prefix_ont_pred_scores.pckl pickle file with predicted GO term/EC number scores for test proteins * model_name_prefix_ont_model_params.json JSON file with metadata (GO terms/names, architecture params, etc.)

See examples of pre-trained models (*.hdf5) and model params (*.json) in: trained_models/.

Functional residue identification

To visualize class activation (saliency) maps use viz_gradCAM.py script with the following options:

  • saliency_fn str, JSON filename with saliency maps generated by predict.py script (see Option 6 above)
  • list_all bool, list all proteins and their predicted GO terms with corresponding class activation (saliency) maps
  • protein_id str, protein (PDB chain), saliency maps of which are to be visualized for each predicted function
  • go_id str, GO term, saliency maps of which are to be visualized
  • go_name str, GO name, saliency maps of which are to be visualized

Generated files: * saliency_fig_PDB-chain_GOterm.png class activation (saliency) map profile over sequence (see fig below, right) * pymol_viz.py pymol script for mapping salient residues onto 3D structure (pymol output is shown in fig below, left)

Example:

```

python vizgradCAM.py -i ./examples/outputs/DeepFRIMFsaliencymaps.json -p 1S3P-A -go GO:0005509 ```

Output:

Data

Data (train and validation) used for training DeepFRI model are provided as TensorFlow-specific TFRecord files and they can be downloaded from:

| PDB | SWISS-MODEL | | --- | --- | | Gene Ontology(19GB) | Gene Ontology(165GB) | | Enzyme Commission(13GB) | Enzyme Commission(117GB) |

Pretrained models

Pretrained models can be downloaded from: * Models (use these models if you run DeepFRI on GPU) * Newest Models (use these models if you run DeepFRI on CPU)

Uncompress tar.gz file into the DeepFRI directory (tar xvzf trained_models.tar.gz -C /path/to/DeepFRI).

Owner

  • Name: Flatiron Institute
  • Login: flatironinstitute
  • Kind: organization
  • Location: New York City

@SimonsFoundation

GitHub Events

Total
  • Issues event: 1
  • Watch event: 30
  • Issue comment event: 4
  • Fork event: 10
Last Year
  • Issues event: 1
  • Watch event: 30
  • Issue comment event: 4
  • Fork event: 10

Committers

Last synced: 11 months ago

All Time
  • Total Commits: 140
  • Total Committers: 4
  • Avg Commits per committer: 35.0
  • Development Distribution Score (DDS): 0.021
Past Year
  • Commits: 0
  • Committers: 0
  • Avg Commits per committer: 0.0
  • Development Distribution Score (DDS): 0.0
Top Committers
Name Email Commits
VGligorijevic v****c@f****g 137
Valentyn Bezshapkin 6****3 1
P. Douglas Renfrew d****w@g****m 1
danielberenberg d****b@u****u 1
Committer Domains (Top 20 + Academic)

Issues and Pull Requests

Last synced: 11 months ago

All Time
  • Total issues: 67
  • Total pull requests: 13
  • Average time to close issues: about 1 month
  • Average time to close pull requests: about 2 months
  • Total issue authors: 35
  • Total pull request authors: 3
  • Average comments per issue: 1.04
  • Average comments per pull request: 0.69
  • Merged pull requests: 1
  • Bot issues: 0
  • Bot pull requests: 11
Past Year
  • Issues: 8
  • Pull requests: 0
  • Average time to close issues: N/A
  • Average time to close pull requests: N/A
  • Issue authors: 3
  • Pull request authors: 0
  • Average comments per issue: 1.0
  • Average comments per pull request: 0
  • Merged pull requests: 0
  • Bot issues: 0
  • Bot pull requests: 0
Top Authors
Issue Authors
  • TengQinglong (3)
  • jiaojiaoguan (2)
  • maovshao (2)
  • shrutiOx (2)
  • happyzhanglol (2)
  • bl-2633 (2)
  • johnnytam100 (2)
  • YangW-Labs (1)
  • OtimusOne (1)
  • daisykuma22 (1)
  • sampritip (1)
  • dhall1995 (1)
  • alexgcsa (1)
  • Ubiquinone-dot (1)
  • PBordesInstadeep (1)
Pull Request Authors
  • dependabot[bot] (11)
  • SoliareofAstora (1)
  • valentynbez (1)
Top Labels
Issue Labels
Pull Request Labels
dependencies (11)

Dependencies

setup.py pypi
  • biopython ==1.76
  • networkx ==2.4
  • numpy ==1.18.5
  • scikit-learn ==0.23.1
  • tensorflow-gpu ==2.3.1