RXNAAMapper

RXNAAMapper is a tool designed to identify binding sites in protein sequences by leveraging language models trained on biochemical reactions. The tool can capture the signal characterizing amino acid (AA) binding sites using linguistic representations for proteins and their molecular substrates, performing unsupervised binding site prediction from protein sequences and reaction SMILES.

setup

To set up the environment, use the following commands: console conda env create -f conda.yml conda activate rxn_aa_mapper

In the following we consider the examples provided to show how to use RXNAAMapper.

generate a vocabulary to be used with the EnzymaticReactionBertTokenizer

Create a vocabulary compatible with the enzymatic reaction tokenizer:

console create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"

use the tokenizer

The example below shows how to use the LMEnzymaticReactionTokenizer with the vocabulary previously created and the tokenizer:

```python from rxnaamapper.tokenization import LMEnzymaticReactionTokenizer

tokenizer = LMEnzymaticReactionTokenizer( vocabularyfile="./examples/vocabularytoken75Kmin600max750500K.txt", aasequencetokenizerfilepath="./examples/token75Kmin600max750500K.json", aasequencetokenizertype="generic" ) tokenizer.tokenize("NC(=O)c1cccn+c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]") ```

train the model

We use WandB for logging, if you don't have a mode configured you can simply disable it by setting:

console export WANDB_MODE=offline

The mlm-trainer script can be used to train a model via MTL:

console mlm-trainer \ ./examples/data-samples/biochemical \ # just a sample train folder ./examples/data-samples/biochemical \ # just a sample validation folder ./examples/vocabulary_token_75K_min_600_max_750_500K.txt \ /tmp/mlm-trainer-log \ ./examples/sample-config.json \ # for a more realistic config see ./examples/config.json "*.csv" \ 1 \ ./examples/data-samples/organic \ # just a sample train folder ./examples/data-samples/organic \ # just a sample validation folder ./examples/token_75K_min_600_max_750_500K.json \ "generic"

Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.

These checkpoints can be converted into a HuggingFace model with:

console checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json

predict active site

Once trained, the RXNAAMapper model can predict reactant atoms and map them to AA sequence locations, indicating potential binding sites:

```python from rxnaamapper.aa_mapper import RXNAAMapper

configmapper = { "vocabularyfile": "./examples/vocabularytoken75Kmin600max750500K.txt", "aasequencetokenizerfilepath": "./examples/token75Kmin600max750500K.json", "aasequencetokenizertype": "generic", "modelpath": "/tmp/rxnaamapper-pretrained-model", "head": 3, "layers": [11], "topk": 1, } mapper = RXNAAMapper(config=configmapper) mapper.getreactantaasequenceattentionguidedmaps(["NC(=O)c1cccn+c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"]) ``` NOTE: The model path should contain both the model binary file and the config.json. These files are generated from the model trained and converted to a HuggingFace model using the script provided in the previous section.

citation

bib @article{teukam2024language, title={Language models can identify enzymatic binding sites in protein sequences}, author={Teukam, Yves Gaetan Nana and Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Laino, Teodoro}, journal={Computational and Structural Biotechnology Journal}, volume={23}, pages={1929--1937}, year={2024}, publisher={Elsevier} }